General Information

  • ID:  hor004672
  • Uniprot ID:  Q93VK8
  • Protein name:  Root meristem growth factor 6
  • Gene name:  GLV1
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  RGF family
  • Source:  Plant
  • Expression:  Rapidly induced by auxin. |Absent from the primary root . |Expressed in stems, hypocotyls, cotyledons, leaves, flowers, shoot apex, siliques, stamens and petals.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0009733 response to auxin; GO:0009786 regulation of asymmetric cell division; GO:0009958 positive gravitropism; GO:0010082 regulation of root meristem growth; GO:0022622 root system development; GO:0030154 cell differentiation; GO:0032880 regulation of protein localization; GO:0048527 lateral root development; GO:2000012 regulation of auxin polar transport; GO:2000023 regulation of lateral root development; GO:2000067 regulation of root morphogenesis; GO:2000280 regulation of root development
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005783 endoplasmic reticulum

Sequence Information

  • Sequence:  DYPQPHRKPPIHN
  • Length:  13
  • Propeptide:  MSCSLRSGLVIVFCFILLLLSSNVGCASAARRLRSHKHHHHKVASLDVFNGGERRRALGGVETGEEVVVMDYPQPHRKPPIHNEKS
  • Signal peptide:  MSCSLRSGLVIVFCFILLLLSSNVGCASA
  • Modification:  T2 Sulfotyrosine;T10 Hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Maintains the postembryonic root stem cell niche.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q93VK8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004672_AF2.pdbhor004672_ESM.pdb

Physical Information

Mass: 181300 Formula: C72H107N23O19
Absent amino acids: ACEFGLMSTVW Common amino acids: P
pI: 9.3 Basic residues: 4
Polar residues: 2 Hydrophobic residues: 1
Hydrophobicity: -219.23 Boman Index: -4591
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 30
Instability Index: 8507.69 Extinction Coefficient cystines: 1490
Absorbance 280nm: 124.17

Literature

  • PubMed ID:  NA
  • Title:  NA